تعیین توالی ژن، کلونینگ و بیان آل- آسپاراژیناز نوترکیب از سودوموناس آیروجینوزا سویه SN4 در اشریشیاکلی

نوع مقاله : پژوهشی- انگلیسی

نویسندگان

1 دانشیار بیوشیمی، دانشگاه شهید باهنر کرمان، ایران

2 استادیار بیوشیمی، دانشگاه شهید باهنر کرمان، کرمان، ایران

3 کارشناس ارشد میکروبیولوژی، دانشگاه شهید باهنر کرمان، کرمان، ایران

چکیده

مقدمه: ال- آسپاراژیناز جایگاه با ارزشی از جنبه کاربردهای پزشکی و صنایع غذایی دارد. تقاضا برای این آنزیم دارویی هرساله چندین برابر می‏شود.

مواد و روش‏‏ها: در این پژوهش، یک آسپاراژیناز از سودوموناس ایروجینوزا سویه SN4، تعیین توالی و در اشریشیاکلی کلون شد. پرایمر‏ها بر اساس آل- آسپاراژیناز از سودوموناس ایروجینوزا سویه DSM50071 طراحی شدند که بر اساس توالی ژن 16S rRNA شباهت بالایی را نسبت به سویه SN4 نشان می‏داد. ژن آسپاراژیناز در معرض هضم آنزیمی توسط آنزیم‏های برشی NdeI و XhoI قرار گرفت و سپس، به داخل پلاسمید pET21a الحاق شد. محصول الحاق به درون سلول‏های مستعد E. coli (DE3) pLysS DH5a با روش CaCl2 ترانسفورم شد. سلول‏های
E. coli ترانسفورم شده در محیط LB آگار حاوی 100 میکروگرم/ میلی‏لیتر آمپیسیلین و IPTG (1mM) رشد داده شدند.

نتایج: ال-‏آسپاراژیناز نوترکیب در باکتری BL21 E. coli پس از 9 ساعت انکوباسیون، به میزان بالایی القا شد و فعالیت آسپاراژینازی بالایی به میزان 4/93 واحد در میلی‏لیتر را نشان داد. ال- آسپاراژیناز نوترکیب تعیین توالی شد و نتایج همردیفی نشان داد که توالی پیشنهادی اسید آمینه‏ایی آن از 350 اسید آمینه تشکیل شده که شباهت بالایی با
ال- آسپاراژیناز‏های سایر سودوموناس ایروجینوز‏ها در حدود 99 درصد را نشان می‏دهد. نتایج نشان می‏دهد که
آل- آسپاراژیناز SN4، باقی‏مانده‏های کاتالیزی و نواحی حفظ شده مشابه با سایر آسپاراژینازها را داراست.

بحث و نتیجه‏ گیری: پژوهش حاضر نخستین گزارش در مورد کلونینگ و بیان آل- آسپاراژیناز نوترکیب از سودوموناس آایروجینوزا در اشریشیاکلی است که منبع بالقوه‏ایی از ال- آسپاراژیناز را برای بررسی اثر ضدسرطانی آن هم در شرایط آزمایشگاه و هم در موجود زنده فراهم می‏کند. 

کلیدواژه‌ها

موضوعات


عنوان مقاله [English]

Gene sequencing, cloning, and expression of the recombinant L- Asparaginase of Pseudomonas aeruginosa SN4 strain in Escherichia coli

نویسندگان [English]

  • Arastoo Badoei-dalfard 1
  • Zahra Karami 2
  • Narjes Ramezani-pour 3
1 Associate Professor of Biochemistry, Shahid Bahonar University of Kerman, Iran
2 Assistant Professor of Biophysics, Shahid Bahonar University of Kerman, Iran
3 M.Sc. of Microbiology, Shahid Bahonar University of Kerman, Iran
چکیده [English]

Introduction: L- asparaginase is in an excessive demand in medical applications and in food treating industries, the request for this therapeutic enzyme is growing several folds every year.

Materials and methods: In this study, a L- asparaginase gene from Pseudomonas aeruginosa strain SN4 was sequenced and cloned in E. coli. Primers were designed based on L- asparaginase from P. aeruginosa DSM 50071, which show high similarity to SN4 strain, according to 16S rRNA sequence. The L- asparaginase gene was exposed to restriction digestion with NdeI and XhoI enzymes and then ligated into pET21a plasmid. The ligated sample was transformed into competent E. coli (DE3) pLysS DH5a cells, according to CaCl2 method. The transformed E. coli cells were grown into LB agar plate containing 100 µg/ml ampicillin, IPTG (1 mM).

Results: Recombinant L- asparaginase from E. coli BL21 induced after 9 h of incubation and showed high L- asparaginase activity about 93.4 IU/ml. Recombinant L- asparaginase sequencing and alignments showed that the presumed amino acid sequence composed of 350 amino acid residues showed high similarity with P. aeruginosa L- asparaginases about 99%. The results also indicated that SN4 L- asparaginase has the catalytic residues and conserve region similar to other L- asparaginases.

Discussion and conclusion: This is the first report on cloning and expression of P. aeruginosa L- asparaginases in Escherichia coli. These results indicated a potent source of L- asparaginase for in vitro and in vivio anticancer consideration. 

کلیدواژه‌ها [English]

  • L- asparaginase
  • Cloning
  • Pseudomonas aeruginosa
  • Sequence alignments

Introduction

Bacterial L- asparaginase has been broadly used as an actual therapeutic agent against lymphosarcoma and acute lymphoblastic leukemia (1- 3). Numerous cases of current research are accessible regarding the use of L- asparaginase in melanoma therapy (4- 6). The use of anti- tumor therapy is based on its capacity to hydrolase L- asparagine to L- aspartic acid and ammonia in serum and cerebro- spinal fluid. Since tumor cells are unable to make endogenous L- asparagine, starvation for this amino acid hints to death of these cells (7). L- asparaginase received enlarged care in current years as food handling helps to diminish the development of acrylamide in carbohydrate-based foods that were fried, baked or roasted (8 & 9). L- asparaginase has also been considered for presentation in the L- asparagine biosensor for leukemia (10). Meanwhile, the statement that E. coli L- asparaginase has an anticancer activity similar to that of guinea pig serum, there has been extensive attention in L- asparaginase from numerous sources particularly microorganisms. Many plants, mammalian and bacterial species can produce L- asparaginases. Although other bacteria, such as Thermococcus gammatolerans (11), Pectobacterium carotovorum MTCC 1428 (12 & 13), Cladosporium sp. (14), Streptomyces (15), Pseudomonas aeruginosa (16), and Actinomycetes (17), Escherichia coli (18)have a latent for L- asparaginase making, but the enzymes from Erwinia sp. and E. coli (1, 7 & 19) has been used as an anti- cancer agent.

Up to now, only L- asparaginase from Erwinia and E. coli has been used in medical application. Because of various side effects of these enzymes, finding other bacterial L- asparaginase received more attention. So, isolation of L- asparaginase gene from Pseudomonas aeruginosa strain SN4, cloning, expression in E. coli is the aim of this study.

 

Materials and methods

Chemical materials: L- asparagine and trichloroacetic acid (TCA) were obtained from Sigma Chemicals Co. L- asparaginase- specific primers used in this study were synthesized by Bioneer Co. (Soft Korea). Taq polymerase and dNTPs were procured from Sinaclone (Iran).

Cloning of PaA gene: Pseudomonas aeruginosa strain SN4 was previously isolated and identified in our lab (20). A BLAST search of P. aeruginosa genome sequence using as a quire, the gene encoding for L- asparaginase from P. aeruginosa yielded a single 1041- bp ORF that was hypothesized to code for L- asparaginase. This strain was grown- up at 30C in a medium containing 0.5% yeast extract, 1% peptoneand 1% NaCl. After 16 h, cells were harvested by centrifugation (10,000× g 10 min, at 4C) and genomic DNA was isolated according to a standard method (21). Genomic DNA isolated from P. aeroginosa strain SN4 was used as the template for amplification of L- asparaginase gene using the primers: pCFP (5- GGAATTCCATATGATGGCCCTGATGCTC- 3) and pCRP

(5- CCGCTCGAGGTATTCCCAGAAGAT- 3), where, the italic sequences are the restriction sites of Nde1 and Xho1 enzymes, respectively. The DNA amplification was approved in a total volume of 25 µl, containing 2.5 µl PCR Buffer, 1 µl of DNA templet, 0.5 µl lµl dNTP mix, 1 µl each of both primers, 0.2 µl Taq polymerase, and 18.7 µl Milli q water. The PCR method included 33 cycles of 45 s at 94C, 60 s at 55C and 45 s at 72C. A final extension time at 72C for 10 min was done after 33 cycles (22 & 23). The PCR product was sequenced and the L- asparaginase gene was exposed to restriction digestion with NdeI and XhoI enzymes and then ligated into pET21a plasmid (Novagen, Inc.) which was previously having the restriction sites (Fig. 1).

The ligated sample was transformed into competent E. coli (DE3) pLysS DH5a cells, according to CaCl2 method. The transformed E. coli cells were grown into LB agar plate containing 100 µg/ml ampicillin, IPTG (1mM) and X- gal (1mM). The recombinant clones were grown up in 50 ml LB medium containing 100 µg/ml ampicillin at 37C. The plasmid was isolated from E. coli DH5a and was used to transform competent E. coli BL21 cells, which were screened with blue/white selection. Colony PCR, double digestion and sequencing were performed to further approve the presence of L- asparaginase gene and also to check the orientation of integration in the plasmid.

 

 

 

Fig. 1- Map of pET21a vector


 

 

L- asparaginase production and purification: The E. coli BL21 cells were grown into LB agar plate containing ampicillin (100 µg/ml). 2 ml of an overnight cultures inoculated into 20 ml of LB medium in Erlenmeyer flasks (100 ml) and grown for 24 h at 37C in a 180 rpm shaker incubator. L- asparaginase synthesis was induced by the addition of 1mM IPTG (isopropyl- β- D- thiogalactopyranoside) after 9 h of growth. 9 hours after induction, cells were pelleted by centrifugation at 5000 g and 4C for 15 min, resuspended in sodium phosphate buffer (10 mM, pH 7.5), sonicated and centrifuged at 10,000×g for 15 min. The supernatant was gathered and used for purification.

The lysate of E. coli BL21 containing pET21aASN was applied to a Q- Sepharose column, an anion exchanger, pre- equilibrated with 45 mM Tris- HCl buffer, pH 8.5. The proteins were eluted (1 ml/min) with NaCl gradient (0.1- 0.5 M) and 45 mM Tris- HCl buffer (pH 8.5). The active fractions were concentrated with ammonium sulphate (80%) and dialyzed. The purity of the enzyme was valued by SDS- PAGE. SDS- PAGE was done according to the method of Laemmli (24) on a slab gel comprising 10.0% (w/v) polyacrylamide (running gel) and 5.0% (w/v) (stacking gel). The molecular size of the purified L- asparaginase was estimated using molecular markers and the proteins were stained with Coomassi Brilliant Blue R- 250. The purified L- asparaginase was dialyzed to remove salt.

L- asparaginase assay: The L- asparaginase activity was investigated by the technique of Imada, utilizing the Nessler reaction (25). In this method, the ammonia liberated from L- asparagine in the enzyme reaction measured by the Nessler reaction. The reaction was started by adding 100 µl cell suspension into the 900 µl of 100 mM L- asparagine prepared in 50 mM Tris/HCl buffer, pH 8.0 and incubated for 20 min at 37C. The reaction was stopped by the addition of 100 µl 1.5 M TCA. The reaction mixture was pelleted by centrifugation at room temperature (10,000 g for 10 min) to remove the precipitate and the ammonia released into the supernatant was determined colorimetrically (A480) by adding 0.2 ml Nessler reagent into tubes containing 0.3 ml supernatant and 1.5 ml H2O. The content in the tubes was vortexed and incubated at room temperature for 10 min, and the A480 values were measured against the blank that received TCA before the addition of cell suspension. One L- asparaginase unit (U) is defined as the amount of enzyme that liberates 1 µmole of ammonia per min at 37C. Ammonium sulphate was used as the standard for enzyme activity calculations. For rapid colorimetric assay the recombinant bacteria were screened using the modified M9medium (1 l: 3.0 g KH2PO4; 6.0 g Na2HPO4·2H2O; 0.5 g NaCl; 5.0 g L- asparagine; 0.5 gMgSO4.7H2O; 0.014 g CaCl2.2H2O; 2.0% (w/v) glucose, and 15.0 g agar) combined with a pH indicator(phenol red). Development of pink color was considered as a positive result for L- asparaginase production (20).

Results

Cloning PaA: A BLAST search of P. aeruginosa SN4genome sequence in NCBI database (http://www.ncbi.nlm.nih.gov/) using the amino acid sequence of L- asparaginase from P. aeruginosa DSM 50071 (accession number: CP012001) as a query sequence, generated a high- probability match to a single 1041- bp ORF, encoding a predicted protein of 346 amino acids. To define whether the supposed P. aeruginosa protein was actually an active L- asparaginase, we cloned and expressed the full- length gene in E. coli and confirmed for its capacity to hydrolysis L- asparagine.

PCR was used to amplify the full- length gene from genomic DNA of P. aeruginosa SN4 (Fig. 2). The PCR product was cloned into the pET21a vector. This plasmid was used to transform the E. coli BL21 (DE3) pLysS as an expression host.
L- asparaginase from Erwinia carotovora has beencloned in E. coli BL21 (26).

L- asparaginase expression: E. coli BL21 containing pET21aASN was grown up in LB medium supplemented with 1 mM IPTG. After 9 h of induction, 2 ml of this culture was added to 2 ml of phosphate buffer (20 mM, pH 8.0) containing L- asparagine (10 mM) and phenol red (0.001%). After 10 min incubation at room temperature, a tube containing E. coli BL21 with 9h induction, showed a dense pink color against the other (Fig. 3). These results indicated high activity of recombinant L- asparaginase about 93.4 IU/ml.

After induction with 1 mM IPTG, sample was picked up at different time incubation (3, 6 and 9 h). Results showed that the maximum L-asparaginase production was echived after 6 h of incubation (Fig 4b).

Purification results showed that active fraction was obtained in 15% of NaCl concentration. After dialysis, active fraction was loaded on SDS–PAGE gel and then the gel stained with Coomassie Blue. Results showed the attendance of only one band with the molecular weight of 35.0 kDa (Fig. 4a).

Gene sequence analysis: The sequence of recombinant L- asparaginase gene consisted of 1041 bp showed more than 99% identity with similar sequences of different P. aeruginosa strains(Fig. 5 and Fig. 6). Results in Fig. 5, showed the multiple sequence alignment of H. pylori CCUG 17874 (Hepy; EIE30409.1), B. subtilis W168 (Basu; AAA22243.1), E. coli (Esco; NP 417432.1), and Er. chrysanthemi 3937 (Erch; AAS67028.1), B. licheniformis (BaLi, WP_044789473), K. pneumoniae JM45 (Klpn, AGT24790), P. aeruginosa SN004 (Pasn) andP. aeruginosa (Paea, WP_023099587).

 

 

Fig. 3- L- asparaginase activity in medium supplemented with phenol red and L- asparagine. Lane 1; E. coli BL21 containing pET21aASN without induction and Lane 2; extract of E. coli BL21 containing pET21aASN after 9 h of incubation induction with 1mM IPTG.

 

Fig. 2- Agarose gel in the cloning process. a) Electrophoresis in 1% agarose gel of PCR product (1) and DNA ladder (2). b) Recombinant construct (1; 6.5 Kb), (2) pET21a vector without insert. c) Restriction endonuclease digestion of polymerase chain reaction product (3; 1.0 Kb), pET21a digested with NdeI and Xho1 (2; 5.4 Kb)  and DNA ladder (1).

 

 

 

 

PaSn      -MAL--MLLLPQAAQAKEVAPQQKLSNVVILATGGTIAGAGASAANSATYTAAKVPVDQL

Erch      MERWFKSLFIIAFFFISTANAADKLPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTL

Klpn      --------------MSSLAFSETRLPHIVILATGGTIAGSAASNTQTTGYKAGAIGVQTL

Hepy      --------------------MAQNLPTIALLATGGTIAGSGASAS-SDSYKSGELGIKEL

Cifr      -MEFFKRTAL-AALVMGFSGAALALPNITILATGGTIAGGGDSAT-KSNYTAGKVGVENL

Bali      ------------------------MKKLLLLTTGGTIASVEGENGLAPGVKAEEL-----

Basu      ------------------------MKKLLMLTTGGTIASVEGENGLAPGVKADEL-----

Paae      ---------------------MLPVKNLFVLYTGGTIGMLQTPQGLAPAGGFEARMRDHL

Esco      ----------------------MQKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALM

: :  *****.

 

PaSn      LASVPQLKDIANVRGEQVFQIASESFTNENLLELGKTVAKLADSDDVDGIVITHGTDTLE

Erch      INAVPEVKKLANVKGEQFANMASENMTGDVVLKLSQRVNALLARDDVDGVVITHGTDTLE

Klpn      INAVPEMSKIAHVEGEQVANIGSENMTSDIILQLSKRVNALLARDDVDGVVITHGTDTLD

Hepy      LKAIPSLNKIARIQGEQVSNIGSQDMNEEIWFKLAKRAQELLDDSRIQGVVITHGTDTLE

Cifr      VEAVPQLKDIAVVKGEQVVNIGSQDMNDDVWLTLAKKINTEC--DKTDGFVVTHGTDTME

Bali      LSYLSDDHSNYTIDCQSLMDIDSTNMQPEHWVMMAEAVYENYS--RYDGFVITHGTDTMA

Basu      LSYVSKLDNDYTMETQSLMNIDSTNMQPEYWVEIAEAVKENYD--AYDGFVITHGTDTMA

Paae      QSLGDAPDLRWRFA-ELQPPLDSANMTQGNWLAMRDAIVAALD-AGHDGVLLLHGTDTLA

Esco      PEFHRPEMPDFTIH-EYTPLMDSSDMTPEDWQHIAEDIKAHYD--DYDGFVILHGTDTMA

.  :    : * .:       : .           :*.:: *****:

 

PaSn      ETAYFLTL-VEHTEKPIVVVGSMRPGTAMSAGGMLNLYNAVAVAGDKSARGKGVLITMND

Erch      ESAYFLHL-TVKSDKPVVFAAAMRPATAISADGPMNLLEAVRVASDKQSRGRGVLVVLND

Klpn      ETPYFLNL-TVKSNKPVVFTAAMRPATAISADGPMNLLEAVTVAADPDARGRGVMVVLND

Hepy      ESAYFLNL-VLRSTKPVVLVGAMRNAASLSADGALNLYNALSVALNEKSANKGVLVVMDD

Cifr      ETAYFLDL-TVKCNKPVVLVGAMRPSTGMSADGPFNLYNAVVTAADKASANRGVLVVMND

Bali      YTSAALSYMLQNIDKPVAITGSQVPITFKKTDAKKNIKDAVRFACDG---IGGVYVVFDG

Basu      YTSAALSYMLQHAKKPIVITGSQIPITFQKTDAKKNITDAIRFACEG---VGGVYVVFDG

Paae      YSAAALSFLLLDLPIPVLLTGSMLPAGAPGSDAWDNLVGALRVLQEGH--ARGVQVYFND

Esco      YTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYP--INEVTLFFNN

:   *         *: ...:        : .  *:  *:    :       * : ::

 

PaSn      EILSGRDASKMVNIKTEAFKSP-WGPLGMVVEGKSYWFRAPVK--RHTVNSEFDIKQI-S

Erch      RIGSARYITKSNASTLDSFRANEEGYLGVVIGNHIYYQNRLDK--LHTNRSVFDVRGL-A

Klpn      RIGAARFVTKTNATSLDTFRAPEEGYLGVVVGGKPQFETRVDK--IHTLRSVFDVRQL-K

Hepy      TIFSAREVVKTHTTHTSTFKALNSGAIGSVYYGKVRYYMQPLR--KHTTESEFSILELKT

Cifr      TVMDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPAR--KHTTSTPFDVSKL-T

Bali      RVILGTRAIKLRTKSYDAFESINYPYIAFIHDKEIEYNKRVPEVKPGA----LKLDT--S

Basu      RVIQGTRAIKLRTKSYDAFESINYPYIAFINEDGIEYNKQVTEPENDT----FTVDT--S

Paae      ALLHGARVSKLRSDAFDAFAELPRPRHAEH------------APVPAAL---GYRQP--R

Esco      RLYRGNRTTKAHADGFDAFASPNLPPLLEA---GIHIRRLNTPPAPHGE-GELIVHP--I

:  .    *       :*

 

PaSn      ALAPVEIAYSYGNVSDTAYKALAQAGAKAIIHAGTGNGSVPA---RVVPTLQELRKQGVQ

Erch      SLPKVDILYGYQDDSEYLYDAAISHGVKGIVYAGMGAGSVSV---RGIAGMRKAQDKGVV

Klpn      VLPKVVIIYGYQDDPEYMYDAAIAHHADGIIYAGTGAGSVSV---RSAAGIKKAQQAGIV

Hepy      PLPKVDIIYTHASMTSDLFQASLKSHAKGVVIAGVGNGNVSA---GFLKTMQEAGQMGVV

Cifr      ELPKVGIVYNYANASDLPAKALVDAGYAGIVSAGVGNGNLYK---TIFDTLATAAHKGTV

Bali      LNTDVCLVKLHPGLKPEFFD-CLKGSYKGIVIESYGSGGIPFEKRNILEKVNELIDSGMV

Basu      LCTDVCLLKLHPGLKPEMFD-ALKSMYRGIVIESYGSGGVPFEGRDILSKVNELIESGIV

Paae      REVNLAVLPLYPGLRAAHLRGLLDSGVEALLLECYGSGTGPSDDEELLALLREAHARGVL

Esco      TPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNK-AFLQELQEASDRGIV

: :   :                 .::    * *            :      *

 

PaSn      IIRSSHVNAGGFVLRNAEQPD--DKNDWIVAHDLNPQKARILAAVAMTKTQDSKELQRIF

Erch      VMRSSRTGNGIV-PPDEAL-------PGLVADSLNPAHARILLMLALTRTSDPAVIQDYF

Klpn      VVRASRTGSGVV-PPDDSQ-------PGLVADSLNPAKARILLMTALTQTKDPQLIQQYF

Hepy      IVRSSRVGSGEI-TSGE-ID----DKTFITSDNLNPQKARVLLQLALTKTNDKAKIQEMF

Cifr      VVRSSRVPTGAT-TQDAEVDD--AKYGFVASGSLNPQKARVLLQLALTETKDPKQIQEMF

Bali      VAITTQCLEEGEDMSIYEVGRKVNQDAIIRSRNMNTEAIVPKLMWALGKNGQQAEVKKIM

Basu      VVITTQCLEEGEDMSIYEVGRRVNQDLIIRSRNMSTEAIVPKLMWALGQSSDLPVVKRIM

Paae      LAAVSQCAYGQVEFGVYAAGSRLRDAGLLSAGGMTREAALGKLFGLLGAGLGRDEAQRWF

Esco      VVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAM

:   ::                      : .  :.           :         :  :

 


Fig. 5- Sequence alignments of microbial l-asparaginases. The alignment was performed using Clustal Omega program. Amino acid residues that are identical in all of the displayed sequences are marked by black. The origins of l-asparaginase and their GenBank accession numbers are as follows: P. aeruginosa SN004 (Pasn), H. pylori CCUG 17874 (Hepy; EIE30409.1), B. subtilis W168 (Basu; AAA22243.1), E. coli (Esco; NP 417432.1), and Er. chrysanthemi 3937 (Erch; AAS67028.1), B. licheniformis (BaLi, WP_044789473), K. pneumoniae JM45 (Klpn, AGT24790), P. aeruginosa (Paea, WP_023099587).

 

PaSn      WEY---------

Erch      HTY---------

Klpn      HTY---------

Hepy      EEY---------

Cifr      NQY---------

Bali      ETPIADDIII--

Basu      ETPIADDVVL--

Paae      ALDLCGENAD--

Esco      SQNLRGELTPDD

 

 

 


 

Fig. 6- Phylogenetic analysis of the L- asparaginase protein of Pseudomonas aeruginosa strain SN4. Bootstrap values and scale bar depicting substitution rate per site are indicated. The phylogenetic tree constructed by the neighbor- joining method showing the position of L- asparaginase of of Pseudomonas aeruginosa strain SN4. Protease from Escherichia coli was used as outgroup.

 

 

Discussion and conclusion

Because of various side effects ofErwinia L- asparaginase, finding other bacterial L- asparaginase received more attention. So, production of recombinant L- asparaginase has academic and practical importance. Up to now, there is only one report about cloning of L- asparaginase gene of P. fluorescens into E. coli BL21 (27) and there is no report about cloning of P. aeruginosa L- asparaginase. Multiple sequence alignment of L- asparaginases showed that P. aeruginosa L- asparaginase SN4 has 43% similarity with other L- asparaginases from E. coli (WP_047081447) and Bacillus subtilis (AID16240). The results also indicated that SN4 L- asparaginase has the catalytic residues and two conserve regions similar to other L- asparaginases from E. coli, B. subtilis, H. pylori, Er. chrysanthemi 3937, B. licheniformis, K. pneumoniae JM45 and P. aeruginosa. In this study, phenol red used as a pH indicator to screen recombinant L- asparaginase. Molecular weight of P. aeruginosa L- asparaginase strain SN4 was about 35 kDa. In this respect, L- asparaginases purified from Pseudomonas stutzeir MB- 405, Thermusthermophilus and Escherichia coli were with smaller Mr values, ranging from 33- 34 kDa,(28- 30). Purified L- asparaginasefrom Bacillus sp., Streptomyces gulbargensis,Streptomyces albidoflavus and S. PDK2 exhibited a molecular weight of 45, 85, 112 and 140 kDa, respectively (31- 34). Recombinant L- asparaginase showed high activity with about 93.4 IU/ml. Gilbert et al., Liu et al. and Oza et al. have cloned and expressed E. coli, E. chrysanthemi and Withania somnifera L- asparaginase gene into E. coli. The enzyme activities of these recombinant strains were 49, 106 and 17.3 IU/ml, respectively. High activity of recombinant SN4 L- asparaginase indicated a potent source of L- asparaginase for anticancer examination in vitro and in vivio.

Acknowledgement

The authors express their gratitude to Research Council of Shahid Bahonar University of Kerman for financial support during the course of this project.

 

(1)  Astana NS., Azmi W. Microbial L- asparaginase: a potential antitumor enzyme. Indian Journal Biotechnology 2003; 2 (1): 184- 94.
(2)  Avramis VI., Tiwari PN. Asparaginase (native ASNase or pegylated ASNase) in the treatment of acute lymphoblastic leukemia. International Journal of Nanomedicine 2006; 1 (3): 241- 54.
(3)  Narta UK., Kanwar SS., Azmi W. Pharmacological and clinical evaluation of L- asparaginase in the treatment of leukemia. Critical Reviews in Oncology/ Hematology 2007; 61 (3): 208- 21.
(4)  Müller HJ., Boos J. Use of L- asparaginase in childhood ALL. Critical Reviews in Oncology/ Hematology 1998; 28 (2): 97- 113.
(5)  Avramis VI., Panosyan EH. Pharmacokinetic/ pharmacodynamic relationships of asparaginase formulations: the past, the present and recommendations for the future. Clinical Pharmacokinetics 2005; 44 (4): 367- 93.
(6)  Pieters R., Hunger SP., Boos J., Rizzari C., Silverman L., Baruchel A., et al. L- asparaginase treatment in acute lymphoblastic leukemia: a focus on Erwinia asparaginase. Cancer 2011; 117 (2): 238- 49.
(7)  Kotzia GA., Labrou NE. L- asparaginase from Erwinia chrysanthemi 3937: cloning, expression and characterization. Journal of Biotechnology 2007; 127(4): 657- 69.
(8)  Tareke E., Rydberg P., Karlsson P., Eriksson S., Tornqvist M. Analysis of acrylamide, a carcinogen formed in heated foodstuffs. Journal of Agricultural and Food Chemistry 2002; 50 (17): 4998- 5006.
(9)  Pedreschi F., Kaack K., Granby K. The effect of asparaginase on acrylamide formation in French fries. Food Chemistry 2008; 109 (2): 386- 92.
(10)             Verma N., Kumar K., Kaur G., Anand S. E. coli K- 12 asparaginase- based asparagine biosensor for leukemia. Artificial Cells, Nanomedicine, and Biotechnology 2007; 35 (4): 449- 56.
(11)             Zuo S., Xue D., Zhanga T., Jiang B., Mu W. Biochemical characterization of an extremely thermostable L- asparaginase from Thermococcus gammatolerans EJ3. Journal of Molecular Catalysis B: Enzymatic 2014; 109 (1): 122- 9.
(12)             Kumar S., Pakshirajan K., Venkata DV. Localization and production of novel L- asparaginase from Pectobacterium carotovorum MTCC 1428. Process Biochemistry 2010; 45 (2): 223- 9.
(13)             Kumar S., Venkata DV., Pakshirajan K. Purification and characterization of glutaminase- free L- asparaginase from Pectobacterium carotovorum MTCC 1428. Bioresource Technology 2011; 102 (2): 2077- 082.
(14)             Mohan- Kumar NS., Ravi R., Manonmani HK. Production and optimization of L- asparaginase from Cladosporium sp. Using agricultural residues in solid state fermentation. Industrial Crops and Products 2013; 43 (1): 150- 8.
(15)             El- Sabbagh SM., El- Batanony NH., Salem TA. L- Asparaginase produced by Streptomyces strain isolated from Egyptian soil: Purification, characterization and evaluation of its anti- tumor. African Journal of Microbiology Research 2013; 7 (50): 5677- 86.
(16)             Bessoumy AA., Sarhan M., Mansour J. Production, isolation, and purification of L- asparaginase from Pseudomonas aeruginosa 50071 using solid- state fermentation. Journal of biochemistry and molecular biology 2004; 37 (4): 387- 93.
(17)             Khamna S., Yokota A., Lumyong L. L- asparaginase production by actinomycetes isolated from some Thai medicinal plant rhizosphere soils. International Journal of Integrative Biology 2009; 6 (1): 22- 6.
(18)             Kenari SLD., Alemzadeh I., Maghsodi V. Production of L- asparaginase from Escherichia coli ATCC 11303: optimization by response surface methodology. Journal of Food Production 2011; 89 (4): 315- 21.
(19)             Maloney KW. Erwinia asparaginase: coming closer to an understanding of its use in pediatric acute lymphoblastic leukemia?. Pediatric Blood and Cancer 2010; 54 (2): 189- 90.
(20)             Badoei- Dalfard A. Purification and characterization of l- asparaginase from Pseudomonas aeruginosa strain SN004: Production optimization by statistical methods. Biocatalysis and Agriculture Biotechnology 2015; 4 (3): 388- 97.
(21)             Sambrook J., Russell D. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, 4th ed. New‏York: 2001.
(22)             Badoei- Dalfard A., Amiri- Bahrami M., Riahi- Madvar A., Karami Z., Ebrahimi M A. Isolation, identification and characterization of organic solvent tolerant protease from Bacillus sp. DAF- 01. Biological Journal of Microorganism 2012; 1 (2): 37- 48.
(23)             Ramezani–pour N., Badoei-Dalfard A., Namaki-Shoushtari A., Karami Z. Nitrile-metabolizing potential of Bacillus cereus strain FA12; Nitrilase production, purification and characterization Biocatalysis and biotransformation 2015; 33 (3): 156- 66.
(24)             Laemmli., UK. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 1970; 227 (1): 680- 5.
(25)             Imada A., Igarasi S., Nakahama K., Isono M. Asparaginase and glutaminase activities of microorganisms. Microbiology 1973; 76 (1): 85- 99.
(26)             Kotzia G A., Labrou EN. Cloning, expression and characterisation of Erwinia carotovora l- asparaginase. Journal of Biotechnology 2005; 119(4): 309- 23.
(27)             Kishore V., Nishita KP., Manonmani HK. Cloning, expression and characterization of L- asparaginase from Pseudomonas fluorescens for large scale production in E. coli BL21. 3 Biotechnology 2015; 4 (1): 1- 7.
(28)             Manna S., Sinaha A., Sadhukhan R., Chakrabarty SL. Purification, characterization and antitumor activity of L- asparaginase isolated from Pseudomonas stutzeri MB- 405. Current Microbiology 1995; 30 (5), 291- 8.
(29)             Prista AA., Kyridio DA. L- Asparaginase of hermus thermophilus: properties and identification of essential amino acids for catalytic activity. Molecular and Cellular Biochemistry 2001; 216 (1- 2), 93- 101.
(30)             Soares AL., Guimaraes GM., Polakiewicz B., de Moraes pitombo RN, Abrahao Neto J. Effect of polyethylene glycol attachment on physicochemical and biological stability of Escherichia coli L- asparaginase. International Journal of Pharmaceutics 2002; 237 (1- 2), 163- 70.
(31)             Moorthy V., Ramalingam A., Sumantha A., Shankaranaya RT. Production, purification and characterisation of extracellular L- asparaginase from a soil isolate of Bacillus sp. African Journal of Microbiology Research 2010; 4 (18), 1862- 7.
(32)             Amena S., Vishalakshi N., Prabhakar M., Dayanand A., Lingappa K. Production, purification and characterization of L- asparaginase from Streptomyces gulbargensis. Brazilian Journal of Microbiology 2010; 41 (1), 173- 8.
(33)             Narayana KJP., Kumar KG., Vijayalakshmi M. L- Asparaginase production by Streptomyces albidoflavus. Indian Journal of Biotechnology 2008; 48 (3), 331- 6.
(34)             Dhevagi P., Poorani E. Isolation and characterization of L- asparaginase from marine actinomycetes. Indian Journal of Biotechnology 2006; 5 (4), 514- 20.